DPCstruct | MC51553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 4.01 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 59.59 |
| Pfam Score | 88.26 |
| Assigned Pfam label(s) | CL0052- PF16891- CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484LXQ2 | 20-82 | LESMDSAVVDRIIEKLTEVRSSKPGKLVQLTESEIKQLCAASRDIFIKQPNLLELEAPIKICG |
| A0A804P019 | 1-61 | MDPALLDDVIRRLLEVKNIKPGKNAQLSESEIKQLCAAAKEIFLHQPNLLELEAPIKICGD |
| A0A1E5R3D0 | 8-69 | None |
| A0A4S2LFT2 | 1-65 | None |
| A0A7R9MKA2 | 1-63 | None |
| A0A2N9GMI9 | 1-60 | None |
| A0A7J8NJE0 | 5-69 | None |
| A0A1R3KKB2 | 1-71 | None |
| A0A7J8WU77 | 1-71 | None |
| A0A4W5QGB0 | 68-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.