DPCstruct | MC51551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 216 ± 39 aa |
| Standard deviation of domain lengths | 38.51 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11882 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A437DF70 | 35-237 | LDFPHCVVHELPELTAESLEAGDNNQFCWRNLFSCINLLRILNKLTKWKHSRTMMLVVFKSAPILKRALKVKQAMMQLYVLKLLKVQ… |
| A0A425BS44 | 70-236 | TGEVPSEPITEFSWRNFYSSINFLRIMQKICKNKAHRNLLLVQYKSSNILKKALKLPQPELRLYTLKLFKNQVPYCGRKWRQGNMRV… |
| A0A3Q0IYK3 | 352-574 | None |
| A0A0B1RWQ3 | 5-199 | None |
| A0A7S1NSG2 | 2-158 | None |
| A0A0N4T560 | 196-446 | None |
| A0A369S8T2 | 560-762 | None |
| R8BQF8 | 150-318 | None |
| A0A1Y1VFE7 | 814-1017 | None |
| A0A1I8IRI2 | 611-757 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.