DPCstruct | MC51546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 136 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A437CUP5 | 1-133 | MLYYTVYQASHMSFVKLFRDLGRFVQDPNTRWDYCVRAKRGQTDTAQPGCFSKDQVYLDGVLKILRYRDRINFPLLMALGKVSFEDV… |
| A0A4W5Q0Z7 | 486-617 | LYYTVYHATRMSFSQLFSHIAQFVQDPAVRWEYCLRAKRGQTDTSQPGCFSKDQVYLDGILRILRHRRNIDFKMLTSLGKVSFEDVE… |
| A0A218V6R6 | 109-240 | None |
| H3C953 | 87-233 | None |
| A0A7J6QPU8 | 542-681 | None |
| C1MRV7 | 163-289 | None |
| A0A183SMY0 | 145-280 | None |
| A0A0J9SD32 | 275-385 | None |
| A0A7J6CTN0 | 869-1000 | None |
| A0A7M3RLT4 | 70-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.