DPCstruct | MC5154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 5.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 43.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04858 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1I739 | 1-73 | MENPQEVLRECLEKFSTPDYIMEPGIFSQLKRYFQAGGSPEQVIELLSHNYKAVAQMANLVAEWLILGGVKVT |
| S4RLJ1 | 9-74 | DDEETQRECLMRFASRDFIMEPIIFTTLKRYFQAGGSPENVIQLLSENYTAVAQTVNLLAEWLMQT |
| A0A183U4P0 | 1-82 | None |
| A8QGZ2 | 8-83 | None |
| A0A7J8DJT3 | 35-105 | None |
| A0A803J950 | 167-248 | None |
| A0A820M9K6 | 7-71 | None |
| A0A835XT62 | 1-73 | None |
| D3BTJ5 | 198-271 | None |
| A0A7R9H6G1 | 22-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.