DPCstruct | MC51538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 160 ± 18 aa |
| Standard deviation of domain lengths | 17.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L7M7I0 | 107-270 | ILTPKAGNSGSAYHVSDGTSSSAAHVSAAAALIRAKYPDLTAGQVVNRLTKTAGLPDSAKGTSLPDEKYGYGYIRPLAALTENIPAG… |
| A0A1E7NC83 | 1-154 | MSGTSDATAYVSATAALIRSKYPNLSAGQVINRMIKSATPPANGTVVPNNHYGYGTVSPAKALDPNPAVDNGPKDNPLAKRPESKGT… |
| A0A7Y9S381 | 1-170 | None |
| A0A7X5R249 | 265-449 | None |
| A0A0A0BN83 | 20-190 | None |
| A0A0A0BWP2 | 2-148 | None |
| A0A1C4URY2 | 2-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.