DPCstruct | MC51536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 442 ± 36 aa |
| Standard deviation of domain lengths | 35.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5W2H8 | 1-411 | HFTCSDPAYSFSELLKKLDRNPSTLRLPGNTNQEAEGYLKMGYVPAPHYLRQGARTVSWYHGPLTTGPETADISLPVPASDQLLRYY… |
| A0A1E7N708 | 28-474 | FETLADSGIGFGDVVANLAAATDTLLRLPLSGGGADGDVPQRLASGATALPHRLESGERSFAFYRGPLTATPAQALPAPADPRLESA… |
| A0A2T5LKV6 | 319-831 | None |
| A0A5B2VM80 | 281-721 | None |
| A0A7G3FN52 | 277-675 | None |
| F4QUA6 | 226-628 | None |
| G1XFK0 | 153-565 | None |
| A0A428RR19 | 1-452 | None |
| A0A395SIM3 | 259-747 | None |
| A0A1Y1ZEK7 | 291-742 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.