DPCstruct | MC51532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 8.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495ZFL2 | 3-89 | TENVEIILKLPKSILAVMDSTETSIGQSIMETVAVSLYHRRQISLGKAAEIAGISVWQMNQILSKYDVSLDYTAEDAAQDWNTLREI |
| A0A7C1SBZ3 | 1-103 | MSERLSIVIPSEMNVDLEKLQKILKMDKSTVIRHLLSKSIREVKIETFLDEYRKGKLSLGKAAELAGVNLWEFIEQCRKNQIQLDLS… |
| A0A7C6ZTR9 | 17-105 | None |
| A0A523AL01 | 1-103 | None |
| A0A838RF38 | 1-73 | None |
| A0A450T842 | 1-65 | None |
| A0A1W9WL79 | 2-79 | None |
| A0A521W2G4 | 4-92 | None |
| A0A1J5ADT4 | 1-84 | None |
| A0A1Y1Q347 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.