DPCstruct | MC51531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 133 ± 19 aa |
| Standard deviation of domain lengths | 19.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5X6W5 | 1-122 | MDKDFPGESEVGSVHYAPNSRSDYDWDNPAPVWSYADDWLTYPHLPRKRKLMSNKDWGSLPGVPAIVRHHKWWMERIPKAPGVTDGF… |
| A0A7V3UYB5 | 146-280 | NHADGRDRTPPEEWPSLLFWGKFVGSDASHKIVTKPARCGWTHYAPNSESDYDWANKRYVETDIEDWQPDAPGKTQLLNCDRWGCDG… |
| A0A1F7GDM1 | 757-902 | None |
| A0A351LAL7 | 877-984 | None |
| A0A7C4C851 | 220-334 | None |
| A0A399Z4P8 | 109-251 | None |
| A0A357YKN7 | 1-123 | None |
| A0A7Y5PW27 | 589-706 | None |
| A0A7V1WAE3 | 236-342 | None |
| A0A497AMU6 | 581-725 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.