DPCstruct | MC5153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Standard deviation of domain lengths | 7.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 46.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07444 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A161KBX0 | 1-109 | MILFDFDFTVFLALTLLIFSIYYYFICQKKYVLQDSDVFFSCLILLNGGILLFQGWRLDPLLLFTQIISTIMIISFANENISLRNQI… |
| A0A7J7PV15 | 1-102 | MINVDFASPSLVLGITLIGCGIALLQVRNVQREVSRDADIVVAAMISIVGSTLIFQGWRLDPLLLLCQALTTSVAFWYGLETFKLRG… |
| A0A061QUA0 | 74-164 | None |
| A0A7D3Q556 | 1-110 | None |
| A0A830HC10 | 103-200 | None |
| A0A846DH13 | 1-94 | None |
| A0A845WZ88 | 9-102 | None |
| I0YXJ2 | 1-91 | None |
| K8EPU2 | 72-164 | None |
| A2CI55 | 18-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.