DPCstruct | MC51524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 156 ± 27 aa |
| Standard deviation of domain lengths | 27.02 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 35.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8LML5 | 20-175 | VGTMTPAGAVCSNGLEGIQSTSLDACCVEECGLCGGVGCTPANTSSLTSADCCATEIIESGTLCEVSMAAPCIITTAAASNDSVCEN… |
| D7G3T6 | 19-168 | TDEVPMCDGGIVGIQQSDICCSSSCGSCGGTGCTSRDGGSEACCGGGVRASGRFCSVTGEAPCMTGPAPTPEPTPAPTPPPTDEVPM… |
| A0A0K6SB93 | 661-843 | None |
| A0A7R9U2K2 | 54-257 | None |
| D7FJ69 | 11-187 | None |
| A0A7S4N5U2 | 261-376 | None |
| D7G3U7 | 330-470 | None |
| D7G8L8 | 1-160 | None |
| A0A0K6SB61 | 462-628 | None |
| A0A835Z887 | 14-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.