DPCstruct | MC51520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 88 ± 14 aa |
| Standard deviation of domain lengths | 14.20 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2NWR4 | 10-97 | RYADLLGRLYPGRDRLPRLIAHTLRHGEMTRGDAPFVAGVRDRAARNDLALLLKAGFLRSDTPKGPVRVGFPLDYRESLFPNLFSTRE |
| A0A7Y1BLG9 | 4-95 | LRERLARIVQFEPRFIHAGIKPEGARALYLLIIQGEVLRADFKAYFNLHDKTAANQLKELLLLGVVEAPSPKSRDLYPGFPVWFAQL… |
| A0A3B0XUG2 | 4-74 | None |
| A0A7Y8T691 | 3-62 | None |
| A0A2L0WM77 | 2-85 | None |
| J9DDD2 | 69-154 | None |
| A0A1I7KZE6 | 2-74 | None |
| A0A837DYH0 | 3-77 | None |
| A0A539D429 | 442-532 | None |
| A0A7X8SE47 | 311-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.