DPCstruct | MC51519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 235 ± 29 aa |
| Standard deviation of domain lengths | 28.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2NNM1 | 49-275 | VHRFGRFVDPWLEDQTIIDEIRGEGGESDFRLRYAARTDSPPQMAALRQRVENIFFFNEEWLGAVTQLIRYAERKGRPVKIDIVAYS… |
| G6E9H0 | 23-183 | SATIELIAYSPEDILRAIASSAFGFPGYVPTFRLDIVHDGETERFIGLPEWDGTKPDFAKVIAQHFNGDDFSYFLACHFGENRTMNR… |
| A0A7V8S1M1 | 1-224 | None |
| A0A2S4HT18 | 285-536 | None |
| A0A2S9QLG8 | 304-544 | None |
| D4B830 | 313-530 | None |
| A0A2N9BFW3 | 440-714 | None |
| A0A0Q6WRZ1 | 228-472 | None |
| A0A3P8LZK6 | 261-479 | None |
| A0A486NGT3 | 72-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.