DPCstruct | MC51514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 150 ± 15 aa |
| Standard deviation of domain lengths | 14.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 28.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3XAH6 | 3-135 | LLTAPGGLLDRVSVEGTALERILAPGGLADRLLAEDGPVERMFAEDGIVERMFAEDGVIDKLLAKNGPLEQFTEAAEILSRLAPAVE… |
| A0A5A7WSM5 | 162-312 | TSEGGVVDKLTAPDGVLEKLMAKDGVLDKLTEPDGVLDKLTEPEGVLDKLARKDGILDKLTSTGGVLDRAAVDGGLIDQLIGEGGAI… |
| A0A1P8YHI6 | 1-152 | None |
| A0A848KG55 | 26-180 | None |
| A0A1X0D5X6 | 104-275 | None |
| A0A839RRJ3 | 28-189 | None |
| A0A1A3U871 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.