DPCstruct | MC5151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.11 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6X9Q2 | 211-269 | NSVPLCIGHGEPCVARIVKKEGPNLGRKFYVCRRAEGPSSNPEARCDYFKWETSEAGKK |
| A0A7J7PN16 | 1-64 | MQPPKCHCKEPSVVRVSKKQNENYLRQFYCCARPAGPPGVGRCSFFQWATAPKVKPKAVGQAAL |
| B7ZA71 | 293-346 | None |
| G3PF93 | 321-377 | None |
| A0A4Y7I7G9 | 297-355 | None |
| C1EJ74 | 197-262 | None |
| A0A7N0T2Z5 | 1-71 | None |
| A0A7S4DC49 | 430-492 | None |
| A0A287S1V4 | 180-239 | None |
| D7SNZ3 | 51-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.