DPCstruct | MC51500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 132 ± 26 aa |
| Standard deviation of domain lengths | 26.04 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6YPM5 | 20-134 | FSCPYCGEQDKFVQGVLDRIVSITELHQDDEVAETIKAGKYYYQVPLSFLPGIGKKTIEKLLKKLGTEMNVLHYASEPEIATVVGKK… |
| A0A7X3VYE9 | 239-403 | SYTVEFYPEEGKYHHSGHRACHVKMSTEEVRERGEVCRSCGRPITVGVSYRVEELGGRQVDTWVGDDGLVHGDTGRPPFKSLVPLRE… |
| A0A1H0WHA3 | 33-161 | None |
| A0A1W9SI97 | 269-417 | None |
| A0A849R924 | 17-138 | None |
| A0A4V6NRU2 | 61-157 | None |
| A0A1H7U2C3 | 56-202 | None |
| A0A1V4QLF4 | 268-416 | None |
| A0A1J4WFY2 | 34-181 | None |
| A0A5S9MAC7 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.