DPCstruct | MC5150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 102 ± 13 aa |
| Standard deviation of domain lengths | 13.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10693 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7PGL6 | 55-166 | SALAVRMEPANALSLPTWAIHVSSVTEWVAAMALMWKYAEVSGNPRWKGMTWGMMPSLGSAMAACTWHFFYNSPDLDFLVALQAFLT… |
| A0A5Q2N8D7 | 5-99 | LSLPTWIVHIASLVEWALAMILFYAIGKKADNVWFRRMPIAMIPYLLSGFFAIFYHLTHDTVQWLSDIQGYLTFLGSVSFAIWGYLY… |
| A0A2H5NTG7 | 2-81 | None |
| A0A7R9YGI5 | 1-93 | None |
| A0A7C9DG03 | 93-195 | None |
| A0A2Z6UTY9 | 2-91 | None |
| M0ZXG0 | 10-121 | None |
| A0A7S2MJG9 | 102-201 | None |
| A0A0D9XFR9 | 59-161 | None |
| A0A0H3K5F4 | 3-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.