DPCstruct | MC515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 9.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.82 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J9E135 | 15-102 | STAGKQQKTRALAIDSNQPEYVRGWVRNEIRRVERLKSQGITRRLRIPPGFDLAHWRGHESKKGFDYTYTDLNTKGLHRTQHRHDNKG |
| A0A254NR72 | 4-79 | IAKDDKVSSALKGEIKRDINQIKRKKRSTVRVPQGHVLAHRRGKEARKGNGYADSDLQVVKSHKTQHKYDNNGKKR |
| A0A8B3FC27 | 7-95 | None |
| A0A0Q5NLR2 | 85-161 | None |
| A0A850RQ41 | 3-67 | None |
| E8JZL0 | 51-143 | None |
| A0A2S8AFN8 | 6-77 | None |
| A0A841W4S4 | 78-167 | None |
| A0A4Z0FNZ1 | 128-217 | None |
| A0A4Q9ZDW4 | 40-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.