DPCstruct | MC5149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 9.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17420 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9ILV0 | 3-85 | KEGDLRVWHIPQVPMKAFYVEVKSIEEAIKILNVLANYDDFEFINKVKPDYSNVQGLERWENGGWIEWEDENYNSILEVIDEA |
| A0A1S8CS96 | 19-104 | FKNPLRVWWIPQFPMDEPFYVAVNTVEEGRLIMDTLAKYDIFQFENRIKPDYSNAGGLEEFEDGEWHEWQNEEGDTIDDLLRAEAG |
| A0A2I4NPN1 | 1-89 | None |
| A0A0F9APH3 | 10-91 | None |
| A0A843H098 | 1-72 | None |
| A0A1Q6V1X8 | 67-158 | None |
| A0A659APM4 | 100-189 | None |
| A0A4Q2UM93 | 1-90 | None |
| A0A1U7CI94 | 64-152 | None |
| A0A1U0V3J2 | 3-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.