DPCstruct | MC51488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 55 ± 8 aa |
| Standard deviation of domain lengths | 8.16 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7YQ43 | 1-69 | MESGGVKGTGETPKITEIKEKDLGKHIVKGKNGRKELAPNVRYITEDGYKYTTDELGRIVDVEAEGLIL |
| A0A2K9EL63 | 33-80 | DNETVVEYGDHFAMDGRRKALKPNVHYTSPEGYTYRTDELGRIISCEG |
| A0A6N4DL22 | 33-88 | None |
| A0A0E1VAA1 | 1-59 | None |
| A0A842DQ19 | 62-107 | None |
| A0A259UD35 | 487-550 | None |
| J8HSF4 | 52-103 | None |
| A0A0C1TZ71 | 206-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.