DPCstruct | MC5148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 202 ± 32 aa |
| Standard deviation of domain lengths | 31.51 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A352X377 | 17-207 | AACTSLYNQAILDAGTYEEGEIQPLTPIVDNSVKMVTWTSWSGYQLGQNTLGIDLWGTIVPQLQEKCQTFGVDLNLRLEQLLGLPPN… |
| A0A254RXZ1 | 205-395 | YPLVTIEEGSDMASLSGDNTQVVLVTWHNDPDRFKDGEVTTLKDDEVLWAYTDKEFLKWFRENHDKVDNWDIRLKQLLGKSPETDNR… |
| A0A661V9J7 | 13-216 | None |
| A0A2P8WDQ6 | 22-252 | None |
| A0A2N2J037 | 40-296 | None |
| A0A1P9Y902 | 188-394 | None |
| A0A316SKV0 | 2-156 | None |
| A0A318N2K2 | 393-582 | None |
| A0A6J4F6N2 | 81-258 | None |
| A0A7X7LA45 | 20-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.