DPCstruct | MC51476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 11.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2G276 | 6-101 | EFRYPGPKPNSKETGILMLADSCEAASRSLESPTHKRLESLIDSIFDRRIQDGQLDDSDLTFRELDQIKDTFLSMLVGMYHVRVKYP… |
| A0A3E0PTP8 | 83-181 | ENGEVDPADFRHVGHKPRTAESAIVMLADSLEAACRAVFQTEEPSPHAIEKVVDRVVNEKLDDGQLSESPLTLADISKIRGAFLESL… |
| A0A3D1YZA6 | 161-283 | None |
| A0A7X7KUF6 | 521-645 | None |
| A0A6L9ITR0 | 582-703 | None |
| A0A7W0W865 | 2-112 | None |
| A0A2E3RIM4 | 839-955 | None |
| D0LXD8 | 430-541 | None |
| A0A7C0W2S5 | 131-256 | None |
| A0A7V8YE53 | 232-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.