DPCstruct | MC51472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 315 ± 63 aa |
| Standard deviation of domain lengths | 62.50 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A345PP51 | 156-457 | SSLDVLERLPNTIYFKSLKLKINHDPNSPLAESVIEKLDAFHKLKLPYTFLSSVLQQCTDLYALDALLNKTLIKCASGGYAIESKLQ… |
| A0A8A5VZ19 | 35-355 | KTLEEKRINLSSVSSILSKAGANAVKAFKELYDLWFDTEGKKTRYLIKLEESGVDLVRMSSILHGAGANAPRAFKELCDLWFDTEGK… |
| A0A4Y2P9C4 | 368-677 | None |
| A0A4Y2M342 | 5-332 | None |
| A0A2R8F106 | 70-431 | None |
| A0A2U3QWN8 | 27-288 | None |
| A0A2U3R2J1 | 1-389 | None |
| A0A2U3RA52 | 83-382 | None |
| A0A2U3REP1 | 1-371 | None |
| A0A3N2QDR0 | 66-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.