DPCstruct | MC51466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.45 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 59.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443RRI3 | 1-79 | MVPRPNCVNVLVTTTHLVPALAKILLYNLGSVFPIENIYGSMKVGKDNCFQRIQDKFGRKCTYVVIGDGKDEETAAKNV |
| A0A182P6G1 | 35-114 | LNMIAQRENCVNVLVTTTQLVPALAKILLYGLGQVFPVENVYSANKIGKEQCFERIVTRFGRKSTYVVVGDGQDEENAAK |
| A0A7R9H489 | 234-307 | None |
| S4RYN2 | 111-194 | None |
| A0A183T432 | 66-147 | None |
| A0A7J8C1K6 | 320-400 | None |
| A0A673AYM2 | 181-261 | None |
| A0A3P7WW31 | 31-117 | None |
| A0A5N3W7N9 | 324-398 | None |
| A0A822GSN1 | 49-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.