DPCstruct | MC51465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 443 ± 75 aa |
| Standard deviation of domain lengths | 75.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.88 |
| Pfam Score | 76.39 |
| Assigned Pfam label(s) | CL0020- CL0229- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443RP23 | 83-508 | IRFVCNLDEHFFRGVRLSKKLIGVRDLIDCDKTAIKMSDVEYLPMRRTQNENGSMFSLYKSDERNRALILCEWKHELDGDIENLVKS… |
| A0A6A7BT13 | 6-392 | VDLSYLGVSYLWTERLGNEKRRVRNQKATMNSAIHAWGKNVPAFEGERTSFPEHRQLCLAVCGWAFTAETLEDECQQMIDRGEPYEA… |
| A0A3Q0J9U2 | 24-404 | None |
| A0A5K3FHL8 | 49-506 | None |
| A0A6F9DLQ3 | 357-901 | None |
| A0A0R3S432 | 3-331 | None |
| A0A1B9IVR4 | 542-990 | None |
| A0A183R5Y9 | 1-549 | None |
| Q2UEF6 | 103-610 | None |
| B8CDZ4 | 17-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.