DPCstruct | MC51464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 140 ± 22 aa |
| Standard deviation of domain lengths | 22.26 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443QUT8 | 1-158 | MLKSVQNTYIQRSSGCDHMHCTRCQTNFCYRCGDKLRRLKFFGDHYSKLSVFGCKYRYKAESPVQRKLIRGAVFGTKIMIAPVLGSL… |
| A0A820KXR1 | 40-173 | MLKKWAREVHYGQHNAQQCPSCKVYIQRTKGCDHIVCLRCKTEFCYKCGGRFRDIKFIGDHYSELSVLGCKYRFYPDRPLKRRLIRG… |
| A0A2C9JKV5 | 502-657 | None |
| A0A3M6U2J3 | 361-506 | None |
| A0A1S3IJ79 | 422-586 | None |
| H2PK94 | 68-219 | None |
| F7DIU6 | 491-602 | None |
| A0A674HMW2 | 147-258 | None |
| A0A2Y9G2M0 | 494-591 | None |
| A0A6J8DUI0 | 380-545 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.