DPCstruct | MC51462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 376 ± 43 aa |
| Standard deviation of domain lengths | 43.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 65.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1GKE2 | 142-531 | ASNEEENTGPGPKLYVRDDGTVDWDGALQDRAALQNFGAAVWARINGQDPSTLEDTSQSIAKTTVVAKIEETEEIRELKAQVDLLEA… |
| A0A7S0Y556 | 2-410 | NSTAVGSSGPRLYVRDDGTVDWEGALQDRAALRKFGGAVWARINGQTPDDLPEEDSDEKKGFSHESKPAVTAKIEDTPAIQEARKKL… |
| B8C2L4 | 280-678 | None |
| A0A7S2SGM0 | 1-362 | None |
| A0A835XI11 | 299-753 | None |
| A0A7S0WNV6 | 170-528 | None |
| F0YH84 | 35-361 | None |
| A0A7S1M1X2 | 1-302 | None |
| A0A250WTN1 | 317-700 | None |
| A0A388K557 | 1-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.