DPCstruct | MC51461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 147 ± 19 aa |
| Standard deviation of domain lengths | 19.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0UJ10 | 27-171 | TYVSLKQRIPTYSKYGFIIGLGAKEYSVIGNSLRKGDLKGAVPYLLTEPSQPPPPSVDALLKMVLFASGMLTSPNYSGPSKRLLVAR… |
| A0A7S0AK77 | 44-190 | GDTSFPKQMPFVLSQQRYDALKKYGERVIRGTKAVEALGDVINSTPVEEFSTKILPPDAPEYYLRPLGLLANNFLASENTGTTNELF… |
| A0A7S0YR71 | 81-247 | None |
| A0A7S0C8P9 | 1-129 | None |
| K0RLE6 | 247-376 | None |
| B7FP17 | 129-260 | None |
| A0A7R9ZRA0 | 12-139 | None |
| A0A7S0ITW0 | 202-359 | None |
| A0A0M0JFR5 | 66-223 | None |
| A0A0M0JG42 | 29-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.