DPCstruct | MC51460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0UIP3 | 11-93 | LLSKPSGVYSFFNGLAPDNLFFHGVACNVVKLQLSKLNLDTEFLQCQMTAPPDRDTETSKTWEGIRRKYWHGRDVYYLPRSTW |
| A0A287SF94 | 2-86 | REFHEHLPELLKPGGVYSYFNGLCGDNAFFHVVYCQLVALELASLGYSTQFIPLPVKDCLKEEVWEGVKQKYWQLDTYHLPVCQA |
| E3KUW8 | 105-202 | None |
| A0A6V7NLW3 | 246-334 | None |
| A0A093Y793 | 471-562 | None |
| R1DQJ3 | 159-254 | None |
| A0A376B9I1 | 390-487 | None |
| A0A4S4LUI1 | 348-447 | None |
| A0A0E9NGA5 | 340-428 | None |
| A0A1I8FJY1 | 405-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.