DPCstruct | MC51453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 9.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0132 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7LGF3 | 1-89 | MPMRATIAKWVEIVAVRLPDSVAKQMDVHEDSAVELAVEDHRLTVTPARPRYTLDEVLAGATPAKSIGVTPRRISVTSNYHPPFRYS… |
| A0A077ZFZ3 | 1-72 | MRITIKRWGNSAGMVIPNIVMKELNLQPGQSVEAQVSNNQLILTPISRRYSLDELLAQCDMNAAELSEQDVW |
| A0A7X9XYD8 | 1-89 | None |
| A0A087D5D7 | 1-81 | None |
| A0A369M226 | 30-140 | None |
| A0A5B8XF63 | 1-95 | None |
| S3FMY0 | 6-93 | None |
| A0A7C6UEW5 | 1-85 | None |
| A0A894KBK9 | 22-114 | None |
| A9MQQ4 | 55-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.