DPCstruct | MC51449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 260 ± 45 aa |
| Standard deviation of domain lengths | 44.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R4XDH5 | 2-264 | AAELKLIQAVELKFALTSTDASLERVASIYLCPLLLKLATPYQSNRKKVEEVLAMLDNRIRGNASVKLPFEPLLAQYKDPTVSEVVK… |
| A0A7J9FU76 | 17-265 | ETEELLDRMLTRLALCDDSKLQALLSKLLPLTISSLSSSSQLVRNKVLEILSHVNKRVKHQPEIGLPLTELWSMYTEADATPMVKNF… |
| A0A086JJI3 | 22-332 | None |
| A0A820V1N9 | 2-340 | None |
| A0A820YFU4 | 15-325 | None |
| A0A8B6CF95 | 2-238 | None |
| A0A821LKA4 | 15-329 | None |
| A0A1S8AA65 | 2-297 | None |
| A0A0D9XWN6 | 2-221 | None |
| A0A1D6QH74 | 5-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.