DPCstruct | MC51445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 431 ± 94 aa |
| Standard deviation of domain lengths | 93.79 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.92 |
| Pfam Score | 77.00 |
| Assigned Pfam label(s) | PF13821- CL0361- PF12066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R4XBK8 | 5-404 | YDDYTTDLLARTAKPYATQQIEQAWFQDMYDGVDHTLALKIECLLKFKLDYNAGHYKDFSIELPGSATDYAMDARVPDPLILDGEIS… |
| A0A6G1SFV1 | 63-483 | LARYSEYKTGFTRKRIDDFFKEHQEEEWFRTKYRPIELKKIEEATKESKARRKELYSKLIEKQSTDNFFLDYQHNETLAQFLENFSL… |
| A0A438FLU0 | 3-362 | None |
| M7WC62 | 103-439 | None |
| A0A2K3P1B6 | 20-419 | None |
| A0A817CHE3 | 583-1031 | None |
| A0A4U6UKX6 | 20-417 | None |
| A0A3Q0INH0 | 249-577 | None |
| A0A061R2X8 | 95-539 | None |
| C3ZTZ3 | 12-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.