DPCstruct | MC5144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 284 ± 33 aa |
| Standard deviation of domain lengths | 33.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18949 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B0HK17 | 2-244 | AGAFLAIDLAWKALALLVAIVTPVYAAKPSSVQEGWRGTMTAYSRAIVISFVGISWIVTMLYGNEYIAYVGEGFRGVKLVYVVPIVA… |
| A0A7C1BBP6 | 208-467 | RTIYSTILALIVGFVLFQSHSSILSIPYLFLTLVFLFYRSIHSSELLALFLGALGPVSIYNLGRRKLKNSFISPFFMGFGAITVGYT… |
| A0A1V2YIM4 | 224-449 | None |
| A0A2M7J7G6 | 342-618 | None |
| A0A537JCL8 | 46-362 | None |
| A0A1Q6Q7J8 | 391-711 | None |
| A0A7C6E1F8 | 142-394 | None |
| A0A351E8Z2 | 238-550 | None |
| A0A4Q5NZS9 | 347-671 | None |
| A0A2N1PU73 | 392-674 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.