DPCstruct | MC51435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 75.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q10161 | 551-625 | MSQNLVQQATAFLLDALKDDNPEHSHLQTRLLEINLINAPQVADAILGNQMFTHFDRAVIASLCERAGLVQRALE |
| A0A819LPT4 | 88-170 | DLTQVVDVFLESNLIQQATAFLFEALKNNREDQGHLQTRLLEINLMQAPQVADAILGKNMFTHYDRPHIAQLCEKAGLLQRAL |
| A0A819NSB9 | 353-422 | None |
| A0A7J8Y5H9 | 58-128 | None |
| A0A5B7GQ54 | 352-437 | None |
| A0A815MYS1 | 250-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.