DPCstruct | MC5143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 150 ± 15 aa |
| Standard deviation of domain lengths | 15.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538MM66 | 54-205 | RHHAGRPLLIAEYGIPSSRGVSHLGPDGMDHGGHDERAMAELDARLTREIHAAGAAGGIVFAWLDEWFKHTWVTTDLELPAERTRLW… |
| A0A7X8ZLY6 | 166-309 | NSVHRLPILVAEFGIPASRGLTHENPYGWNQGFKSEKEQGEILSRLYEDILEENMLGGLIFTWQDEWFKRTWNTMDYDNPDRRPFWS… |
| A0A2P6NKP6 | 564-712 | None |
| A0A7V4Y7L7 | 471-617 | None |
| A0A437SNX7 | 618-761 | None |
| A0A1F2SSI3 | 544-707 | None |
| A0A1Y1WYS2 | 545-687 | None |
| A0A0Q9R4V6 | 353-548 | None |
| A0A7V9K7K7 | 1-132 | None |
| A0A3E2EHR1 | 84-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.