DPCstruct | MC51426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 126 ± 16 aa |
| Standard deviation of domain lengths | 16.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1N4M4 | 1-109 | MTTSSTSSEGIWPCPFRRFHCCPDGVVGNKGIARLISHLKRLHLSTDERKCVLREAISTDHGLYMAVEETLKLFDQWLCGKCMTLHA… |
| A0A699K074 | 2-145 | ASQGAGRISCPLQGREGCSGGNGKGLTKKYFINHLGTRHFKTNDLKVSYKDRVASDFSLFCALDSTLHQARIWVCRECFCTHTFSKS… |
| A0A0K9RBA9 | 4-131 | None |
| A0A2U1MXM1 | 1-125 | None |
| A0A699GTZ7 | 1-126 | None |
| A0A392M515 | 10-128 | None |
| A0A2U1MLY1 | 1-103 | None |
| A0A2U1Q090 | 1-113 | None |
| A0A0K9RB98 | 3-131 | None |
| A0A2U1LGM0 | 80-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.