DPCstruct | MC5142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Standard deviation of domain lengths | 16.18 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.08 |
| Pfam Score | 91.82 |
| Assigned Pfam label(s) | PF13089- CL0764 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B0HIB0 | 1-103 | MAVDAYRPFPMLLNKSLNLAIVLDDEEDEDERKKLAIVQVPAVLNRFIPLPANNDMHAYALLEDVITTFIHTLFKGYTVSSVTQFRI… |
| A0A2T4RPP0 | 127-226 | LPEPLIEQLQHQFNTEILPTLSPLGIDAYRPFPKLNNKMLNLFVDIRLNDGEIKSAIVPVPTLLDRIIKLEHEGVKYIVFLEDVISL… |
| A0A316P363 | 179-311 | None |
| M5JLM0 | 167-297 | None |
| A0A2H6A6Z4 | 500-623 | None |
| A0A644Y4R0 | 68-209 | None |
| A0A2V5M1B7 | 29-155 | None |
| A0A380FNV4 | 122-246 | None |
| A0A2N6V5H4 | 357-484 | None |
| A0A0F8WYR3 | 133-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.