DPCstruct | MC51417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 87 ± 13 aa |
| Standard deviation of domain lengths | 12.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15567 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A516SCL5 | 5-79 | HDMELQVELPLKFVEVLEVPAGWVFSYNATAYVDDGEINCALVGNAPLIVDRYSEQVHVFGTAHPVAYYVDEYQK |
| A0A365V0V6 | 1-78 | MIPFESARQIAEGFLDAEVRGRFSFSVVIVDGDVEEVDDRYVFPYNGKAYVEAGDWREAMAGNSPIAVDKRTGEACFS |
| A0A5B8BU13 | 30-124 | None |
| A0A318ASZ4 | 75-153 | None |
| A0A1I2WAV8 | 1-65 | None |
| A0A0S8A985 | 12-84 | None |
| A0A5A8AIC2 | 21-92 | None |
| A0A7J9ZET3 | 1-92 | None |
| A0A4R8SGW3 | 2-86 | None |
| A0A345Y870 | 5-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.