DPCstruct | MC51416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 172 ± 37 aa |
| Standard deviation of domain lengths | 37.46 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.85 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | CL0023- PF03649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7S409 | 147-295 | VGTFEAASRVGDYTYRDVRRHLWIALATSGDPWFAPRTWIPVSGMLFGNVLTAATIAASSLTSQLVTQQNGIEWQLCRGASVKEALQ… |
| A0A0S7D004 | 23-167 | VSGSMAAGIGMTLAVIFATGAIAFTPRYALAIGGIVIGNGMTIAVLAGRRFKESVYEHWEEVEGWLALGATPRQATLDLARRSVYSA… |
| G0HAA3 | 254-459 | None |
| A0A661EBJ2 | 40-232 | None |
| A0A2G3BFF3 | 56-244 | None |
| A0A1A6ADB7 | 3-141 | None |
| A0A0B7NHG5 | 53-275 | None |
| A0A835UK44 | 250-463 | None |
| A0A5B7WZF1 | 1-137 | None |
| A0A1Y1YEL7 | 61-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.