DPCstruct | MC51413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 8.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7FZX6 | 8-88 | GNNSNSDFSKKDEFRRYLEKSGVLDALTKVLVGLYEEPDRPNNALDYMKRYLGAPSAVDIDGIKQENSELKIQIEKMKKQL |
| A0A2G9GVI4 | 4-87 | EAKKEAFRKYLESSGVLDALTKVLVALYEQSDKPSSAIEFVQQKLGGPTLAEYEKLQAEVSDLQTRYNELLAAHQEKCREFEEL |
| A0A2H5N3M6 | 140-228 | None |
| A0A2U1QK48 | 344-434 | None |
| A0A7S4JF12 | 14-115 | None |
| A0A3B3DTD6 | 1-93 | None |
| A0A7S0WTD6 | 2-86 | None |
| A0A7J6SR09 | 182-280 | None |
| A0A1D2N4J1 | 1-101 | None |
| A9TGB4 | 3-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.