DPCstruct | MC51411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2151 |
|---|---|
| Mean domain length (aa) | 285 ± 73 aa |
| Standard deviation of domain lengths | 73.43 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.38 |
| Mean intra-cluster sequence similarity (%) | 13.17 |
| Pfam Score | 95.76 |
| Assigned Pfam label(s) | PF05380- CL0062- CL0103- PF01155- PF05035 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378ARN8 | 2-244 | LAEITQHWRDGATPVVMAGMVGSNVGWKIAPYLPLPAAFSDIGQQLTAVGDNIWIIPGLCVSRDDNHNVMRGEETQLLGARALAPSS… |
| B7FYB4 | 59-325 | GVPETSRPISPQQVGSYVVSHLMRITETFLGHDNIKSAVICVPAKFNAAQKLATYQAFRQAGVTVARVVEEPTAAALAYGLNRKEGV… |
| F4PL12 | 6-297 | None |
| A0A378A598 | 3-272 | None |
| A0A2G8LR99 | 39-334 | None |
| A0A378C3S4 | 2-238 | None |
| F4PJ17 | 24-297 | None |
| F4Q5T8 | 15-270 | None |
| L5JRE6 | 23-264 | None |
| A0A7C2LFG9 | 4-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.