DPCstruct | MC5141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 34.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380EK04 | 129-238 | KGMTIGLAMNSVYYYKKEKDGSTFSKKLDDSEVKKQGKQMASEILSRLRENDDLKDIPIHFAIYKQSSEDSITPGEFITQATAEKSQ… |
| A0A0B0HHX7 | 7-104 | VIGLAMNSVHYYETEEGYPREVKISKSDMEKEGKKAAEEIVSRLRQIDGLREVPIVVGLFEQQPKSSIVPGHFFAVGYVDKGSNAIQ… |
| W7BQZ0 | 167-265 | None |
| A0A844EGH9 | 38-143 | None |
| A0A139R7G4 | 8-107 | None |
| A0A2T4RP16 | 1-89 | None |
| A0A845EKV0 | 1-93 | None |
| C2VN78 | 1-87 | None |
| A0A3D0FWK0 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.