DPCstruct | MC51408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 116 ± 17 aa |
| Standard deviation of domain lengths | 16.96 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A223NWK8 | 1-101 | MNKPDSAFELFDAYNKQDPRSLALDGVSEPQEYFFAVKLYKWILKLNPGASEELLLASRSQHIGRWEISFEAYPAFQRIRVKPTRQW… |
| A0A100I3K5 | 1-117 | MDPLTTALTRIDALHSEDPTKVSNTDIPYELHYAEKMTNYLYKHTPDPSPTLQLAIRAQHLKRWEVPRSTYPDGKVGYYSWRTAVAR… |
| A0A6A6ZC45 | 1-115 | None |
| A0A1Y2FXF1 | 10-134 | None |
| A0A0G2H5B6 | 7-124 | None |
| A0A1L9PVZ7 | 446-571 | None |
| A0A0D2MD45 | 45-160 | None |
| A0A090X0L0 | 1-115 | None |
| A0A5C5G1F1 | 18-176 | None |
| A0A3M2A2A5 | 62-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.