DPCstruct | MC51404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 157 ± 20 aa |
| Standard deviation of domain lengths | 19.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17948 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A266Q4T1 | 5-158 | IPNDWQPQDATVQLLAQNGISREFTLNQVLEFRVYWSERGIRHHAWNSKFMKHVMHEWRRHEVEIAKGQSMHIMYSAWQPLQRAFDI… |
| A0A356VM00 | 64-186 | ALEIPLNWQPSPAVEAKLVAAGYQHDAIAHYRELFVISAREQGRALRDPGKAFLAYCQCRAPALQGPLPANWLPSTSVLEKLVQAGQ… |
| A0A5J6NXQ9 | 218-397 | None |
| A0A832QBR7 | 1-151 | None |
| A0A3B9AGC0 | 106-276 | None |
| A0A2E2ID96 | 15-176 | None |
| A0A3N2DP93 | 286-451 | None |
| A0A368C3A7 | 98-251 | None |
| A0A5C7PSX3 | 192-352 | None |
| A0A7K0K1I8 | 4-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.