DPCstruct | MC51401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 216 ± 44 aa |
| Standard deviation of domain lengths | 43.74 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12931 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4SFA4 | 1-222 | MDDRTHNQIMLRFANSIPHNDPLQTLYQLMSGHIPQSSTCCADKKWSDWRPHLAMILGNPTRDHALDRKAIIQLGDSLNAHGRLFAA… |
| A0A1D6QQE7 | 20-160 | DVLVITHLGDCLWKEKNEVAAAHSCYLVVELNIDSYSESARLCLIGVDHLKCPRIFASPEAIQRTEVNEYAKVLGNSQYILLSFQPY… |
| A0A1X2GV39 | 67-274 | None |
| A0A662WP61 | 226-414 | None |
| A0A7R9BAT5 | 2-177 | None |
| H9GJ81 | 295-494 | None |
| A0A0N5D2U9 | 269-527 | None |
| H3B7X7 | 43-268 | None |
| A0A4W4DXJ8 | 248-485 | None |
| A0A2D0QJ33 | 45-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.