DPCstruct | MC514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 4.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 56.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04640 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067EBR2 | 38-102 | FCLDCCMSICLHCSHTHRPHHLLQVRRYVYHDVLRLGDAQKLMNCSFVQPYTTNRAKVIFLHKRP |
| A0A4S8KCD7 | 1-68 | MFCLDGGPAGSFCFYCSSDRHSGHLVIQIRRSSYHDVVRVAEIQEVLDIRCVQTYVINSPRVLFLNKR |
| N1R0B4 | 39-106 | None |
| A0A5D3CQS6 | 4-68 | None |
| A0A1Z5RM67 | 61-132 | None |
| A0A4Y7L6Y1 | 47-112 | None |
| A0A194YNC2 | 52-117 | None |
| A0A4S4EJ47 | 162-227 | None |
| A0A2I0KTQ0 | 69-135 | None |
| A0A059C276 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.