DPCstruct | MC51399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 185 |
|---|---|
| Mean domain length (aa) | 190 ± 39 aa |
| Standard deviation of domain lengths | 39.09 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.01 |
| Pfam Score | 99.47 |
| Assigned Pfam label(s) | PF05649- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B3H8F2 | 2-203 | TRIQDDLFATVNAEWLENAEIPADKPRISAFDELVLKNEKNLAKDLADLSQNLPTDNPELLEAIKFYNKAGDWQTREKADFSAVKNE… |
| A0A7E4S948 | 5-183 | MNTNVNPCDDFYQFACGKWIENNPLPPGYGKSDMNMKMEREVLHYLKRFLALPKSNDEHVAHTKAKNHYKACIDKETRKSRGATPLV… |
| A0A7R9KUC2 | 64-269 | None |
| A0A834AFZ1 | 58-312 | None |
| P0DPD9 | 210-427 | None |
| A0A3Q0JFC5 | 122-323 | None |
| A0A397ELJ0 | 106-255 | None |
| A0A397EPJ2 | 334-517 | None |
| A0A834XPW4 | 10-185 | None |
| A0A834XQ77 | 159-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.