DPCstruct | MC51389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 145 ± 19 aa |
| Standard deviation of domain lengths | 18.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y6LVV5 | 1-128 | MASIAQPIIRGDFHHDGYHLLVNVAGKLYSRACESDIRACLYGWQQDRAASWWEAQVVHYNLLRTNLKDMCKSRLWEAIEQGGLKAQ… |
| S7Q0T5 | 8-122 | PIKAGKFECDSEGFKVKGHERASQSDIEHYLGMTPNFTKKGNLSKRQPDLTRPRAWWEAQIAFYNLKTGKSIAAMQDILRAAVNAGT… |
| A0A0F4GKW1 | 1-144 | None |
| A0A365NGN6 | 14-142 | None |
| X8JED7 | 27-203 | None |
| A0A6A6U2I9 | 11-159 | None |
| A0A0C9XJU2 | 10-138 | None |
| A0A0U5G9C4 | 61-222 | None |
| A0A1E3B9H7 | 10-138 | None |
| A0A5N5QKL3 | 213-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.