DPCstruct | MC5138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 114 ± 11 aa |
| Standard deviation of domain lengths | 11.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K2VF84 | 4-96 | SRPVCPRCGGLVDWFERRVVRSGSGVRVYVYAVHKTGGRVRKCYLGPEDSYVYVSKTHSGDGLVFFGSLRRDRLKLYLSSIIQAISS… |
| Q5DVE9 | 34-153 | CPRCSEFARYIDVDERDGHFYIYAIHYNGTRGHGKPKLERHYLGALEYDYVERFNNINLQGLFNEKRHVEYIKNAANQIDSDRLTAY… |
| A0A3R9QC54 | 8-113 | None |
| V4JP26 | 4-104 | None |
| V4K1K8 | 1-140 | None |
| A0A369T008 | 2-111 | None |
| A0A6B2CNQ1 | 6-144 | None |
| A0A2K2VDP0 | 5-122 | None |
| A0A2A5NYN9 | 6-105 | None |
| A0A497RP52 | 3-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.