DPCstruct | MC51376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 118 ± 17 aa |
| Standard deviation of domain lengths | 16.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 35.23 |
| Pfam Score | 53.31 |
| Assigned Pfam label(s) | CL0116- CL0213- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7EFF4 | 9-131 | CRCQTGRMGIMCRRPCQDIYKSCKLWKEEDRCHWAKPILPFFEDNCAESCGSCQNNGQTLKNPLPPILEPISWIIGRWETETLAGDR… |
| A0A0M3HXS5 | 32-158 | CECALGWMGRYCHRHCRNIYKSCDRWAMEDKCELVRTQTNFFDVNCAVSCNTCTPDSKQVLSDIPIPPSLEPLQFMVGKWHSLAAKG… |
| A0A0B1T6K2 | 5-117 | None |
| A0A4U5NST4 | 4-110 | None |
| A0A0N4VFQ7 | 41-163 | None |
| A0A1I7VGS3 | 9-131 | None |
| A0A2A2KXB4 | 2-97 | None |
| A0A0D8XK27 | 53-181 | None |
| A0A090L469 | 27-179 | None |
| A0A0M3HQA3 | 202-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.