DPCstruct | MC51374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 187 ± 17 aa |
| Standard deviation of domain lengths | 16.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7E785 | 19-217 | IGGETLILSLKKKKSSSVYSGNCYQFTDEIWNAIFTQCSPFDLYLWRRVNKNFKRLIDSRFNNILYLYADRRNIASMLGQESINDGN… |
| A0A2G5VR70 | 39-220 | RNTDKSDDSDPIFDMPMHLMIHIIDQMSFFEQIRLARLSKEVKEHLDEKFQKIRKLELRKRDIDEACASDDQFERHSKAYVAVKIEE… |
| A0A6V7US68 | 28-226 | None |
| A0A2H2HY35 | 50-219 | None |
| A0A0B1RUP4 | 11-160 | None |
| A0A183E7Q1 | 17-204 | None |
| A0A0N4XVS1 | 3-186 | None |
| A0A183CHP9 | 35-248 | None |
| A0A1I7XLG3 | 5-203 | None |
| A0A7E4UQI3 | 112-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.